Scaffold AADWTP_10004304

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold AADWTP_10004304

Scaffold AADWTP_10004304

Overview

Basic Information
Taxon OID	3300002461 Open in IMG/M
Scaffold ID	AADWTP_10004304 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	23538
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (55.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater → Freshwater Microbial Communities From A Drinking Water Treatment Plant In Ann Arbor, Michigan, Usa

Source Dataset Sampling Location
Location Name	Ann Arbor, Michigan, USA
Coordinates	Lat. (^o)	42.296774	Long. (^o)	-83.762994	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075009	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
AADWTP_100043046	F075009	GGA	MADDPSTTALARPMIARDLDKAGKGQLVYVGRDGEVKDPAGVRNRQLAAYLAFGGVTAAGVALAATSFPLLIPFYVLLGGRFLGTVRAVRRVNEASVALSNGDSEQGRELAEPVARAWWAPSRVRALAELRLAIADALDGRTEEALTRVRAARAKLSARLIQHQFSYYTEINLLTALGRTKEARVVLDARGGIPAGEVLKLSHWIAELHLCVAEGAIPAGTLPDGELHDRMRKGLSMTAGRDLLLLCAWCYAQLGDHDEARFAWRQAMEREGSQRLEVAMPKLHTWMEEYRKAHPDVDLPEPEDEEFKHL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.