Scaffold LO132_10134802

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LO132_10134802

Scaffold LO132_10134802

Overview

Basic Information
Taxon OID	3300002465 Open in IMG/M
Scaffold ID	LO132_10134802 Open in IMG/M
Source Dataset Name	Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Pennsylvania State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	859
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake → Freshwater Lake Biofilm Microbial Communities From Frasassi Caves, Italy In Anoxic Conditions

Source Dataset Sampling Location
Location Name	Frasassi Caves, Italy
Coordinates	Lat. (^o)	43.3833	Long. (^o)	12.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026777	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
LO132_101348021	F026777	GAGG	MSKRNALTEQSIVVDDVLSMLTGRPRGSMLSFTDVTRGVHEYIKNNGLRQRFCPHCNAPLTPADRVPATIP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.