Scaffold JGI25129J35166_1012756

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25129J35166_1012756

Scaffold JGI25129J35166_1012756

Overview

Basic Information
Taxon OID	3300002484 Open in IMG/M
Scaffold ID	JGI25129J35166_1012756 Open in IMG/M
Source Dataset Name	Marine viral communities from the Pacific Ocean - ETNP_2_130
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2106
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	18.92	Long. (^o)	-108.7999	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016734	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25129J35166_10127561	F016734	N/A	MSKVKRKSVPTLETKTKQAYESELDKLDLTDSQRDAFDHDVKRSLIDLDTYQDTDTFSLQGYQLRSVMDDIVLAQYVDLSNDGRSVIRNGIHIPLSQVKRTWRLARVVLAGPQCKCAKPGDVVCFPDDKGIKVDNLRVVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.