Scaffold JGI24185J35167_1021317

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24185J35167_1021317

Scaffold JGI24185J35167_1021317

Overview

Basic Information
Taxon OID	3300002493 Open in IMG/M
Scaffold ID	JGI24185J35167_1021317 Open in IMG/M
Source Dataset Name	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1782
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.534	Long. (^o)	-110.7978	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053098	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24185J35167_10213172	F053098	AGGAGG	MGCERCTNSISNPATICQPPVRYNILMVEQVAIRLNGAVYLYRLGDGDVLRLWVSQQSLLPLEPTTHTVLLLNQLDYEPYHINDYTRVPVLCDRSIYAGKPTAKLIHKPTQRTIPLYPSREWLDYLQSHTPIVIHHSERYWVYSEYDSNTVQLYRDCGGRWDSTYRCWVFRELPSATPLQNTPIYPLXSLLSPV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.