NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24185J35167_1032296

Scaffold JGI24185J35167_1032296


Overview

Basic Information
Taxon OID3300002493 Open in IMG/M
Scaffold IDJGI24185J35167_1032296 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1247
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002229Metagenome / Metatranscriptome580Y
F098761Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
JGI24185J35167_10322963F002229GGAGGMVTLLTADGVEEVDYTPSDAEIRASLDDPGLYGMVLGVVTWMRLSSGAGWWTVLFGKRLIVTLAPAGWCWVMDGLGNRGYWSATLSAVVADVCAMYGGCVEED*
JGI24185J35167_10322964F098761N/ASPSFATVDVRLRRLTQYVYVTAGRFRRSGVDYAVYRWHEHPYADDALVERYRFGLRLSDWYGVYDTLYGASAGDTLAILPAPAPALAPARRRG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.