 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300002498 Open in IMG/M |
| Scaffold ID | TOLCLC_10175507 Open in IMG/M |
| Source Dataset Name | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1689 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Northern Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 54.0 | Long. (o) | -114.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042954 | Metagenome / Metatranscriptome | 157 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TOLCLC_101755074 | F042954 | GAGG | MEDIQVRNGLYGFEFRDRDMRRVEERKTYDCKQLWQRNHEIVNLTAQGFKQVEVAEILGITPQTVSNTLNGELGQRKLSELRREKDEDAKKTVEKIRVLTNKALQVYHEIFDNESGEATLKERKDVADTVVLELSGLRAPTKIQSTSVSTVLTAEELAVFRERGLRAARQMGVVIDV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |