Basic Information | |
---|---|
Taxon OID | 3300002507 Open in IMG/M |
Scaffold ID | JGI24697J35500_11222522 Open in IMG/M |
Source Dataset Name | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1907 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Chiroptera → Megachiroptera → Pteropodidae → Pteropodinae → Rousettus → Rousettus aegyptiacus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pointe-Noire, Republic of the Congo | |||||||
Coordinates | Lat. (o) | -4.7 | Long. (o) | 11.83 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002610 | Metagenome | 543 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24697J35500_112225221 | F002610 | AGG | MFSVITNTYNKKTKEPTLMELFTATGNLNKFFFFFLTTGNVR |
⦗Top⦘ |