NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold D14S4_10121429

Scaffold D14S4_10121429


Overview

Basic Information
Taxon OID3300002517 Open in IMG/M
Scaffold IDD14S4_10121429 Open in IMG/M
Source Dataset NameGut microbiomes of Pimephales promelas (fathead minnow) during Triclosan exposure experiment - D14S4- solvent control exposure day 14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1198
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fish → Digestive System → Intestine → Unclassified → Pimephales Promelas Gut → Pimephales Promelas Gut Microbial Communities From The University Of Colorado, Denver, Usa, During Triclosan Exposure Experiment

Source Dataset Sampling Location
Location NameDenver, Colorado, USA
CoordinatesLat. (o)39.7392Long. (o)-104.9847Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016472Metagenome247Y

Sequences

Protein IDFamilyRBSSequence
D14S4_101214291F016472N/ATETLFWNRLVPIEVHFMEKILECLSKTLISFRLKKERRGHLG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.