Scaffold D14S4_10243575

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold D14S4_10243575

Scaffold D14S4_10243575

Overview

Basic Information
Taxon OID	3300002517 Open in IMG/M
Scaffold ID	D14S4_10243575 Open in IMG/M
Source Dataset Name	Gut microbiomes of Pimephales promelas (fathead minnow) during Triclosan exposure experiment - D14S4- solvent control exposure day 14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	689
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fish → Digestive System → Intestine → Unclassified → Pimephales Promelas Gut → Pimephales Promelas Gut Microbial Communities From The University Of Colorado, Denver, Usa, During Triclosan Exposure Experiment

Source Dataset Sampling Location
Location Name	Denver, Colorado, USA
Coordinates	Lat. (^o)	39.7392	Long. (^o)	-104.9847	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079293	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
D14S4_102435752	F079293	N/A	MGKKGDLSNFECGMVVGASWAVPSISQSAQLLGFSRATFSRLYKEWCENGKTSSMGQSCGRKCLVDARGQRRMGRLIQADRR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.