NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24973J35851_1015548

Scaffold JGI24973J35851_1015548


Overview

Basic Information
Taxon OID3300002547 Open in IMG/M
Scaffold IDJGI24973J35851_1015548 Open in IMG/M
Source Dataset NamePolar desert microbial communities from Antarctic Dry Valleys - UQ889
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1091
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location NameAntarctic Dry Valleys
CoordinatesLat. (o)-78.1358Long. (o)164.1187Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001016Metagenome805Y
F002864Metagenome / Metatranscriptome525Y

Sequences

Protein IDFamilyRBSSequence
JGI24973J35851_10155482F002864GGAGGVRGQEPVRIPKEVLEELESVRRYTRARVLDIPTLRYVAMERGKPALDLWIDEHEQEYGRGLLNGFQPEN*
JGI24973J35851_10155483F001016AGGVGPQDPKDVTRDTARDLSALVGELAALKGDATHWLEGPEYSALRHRLEAAHAAAEAALVEARRRVRIDEGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.