NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25385J37094_10033683

Scaffold JGI25385J37094_10033683


Overview

Basic Information
Taxon OID3300002558 Open in IMG/M
Scaffold IDJGI25385J37094_10033683 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1796
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031442Metagenome / Metatranscriptome182N
F051831Metagenome143N

Sequences

Protein IDFamilyRBSSequence
JGI25385J37094_100336832F051831N/AMSAALVALSTPLGAQRRGAWTVGFAGTLGGGWQVEAADVGYARAVRAGPMRVASLTARLGSFVDEGAILGGARGFVFGLTLGGHTGLLPLADLGTETSKSEVGVDLTVEGTAYLGARSPFPQGSPWGALTVLPGLKFGDPDGVQFGLLLGPTLFFGQASDVRPFLGIRFEAPLARREPHP
JGI25385J37094_100336833F031442AGGMVAPQLDTEHPGIRVIAEVASVLQSGLASGVALRGVVGALRRGLNLRRCRLWLRTPDGTRYAPVTTPGDEAEPAGYAPPVADWVRQGAQREGTAG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.