NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25385J37094_10079103

Scaffold JGI25385J37094_10079103


Overview

Basic Information
Taxon OID3300002558 Open in IMG/M
Scaffold IDJGI25385J37094_10079103 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1025
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017701Metagenome / Metatranscriptome239Y
F074693Metagenome119N

Sequences

Protein IDFamilyRBSSequence
JGI25385J37094_100791031F074693N/AMNLDQPTYETMNRINAAIAQAMELCPRPELVSWGRRWISGDDRSRETVASIAAAIGVVNVPPDPFARELXEAGRRALXPDELFDWTXKGAVLAALEWTRADPKVGKYHENLAGRIAFLASLMGETWNAHRRLIGRRLSPAPE
JGI25385J37094_100791033F017701N/AGPPVQYEDTIEIRGVTVMRQTDVALLCRXGNQHRWIAPTQLQPGSTVARSGDVGTIVLKRPFAVEQGLVPFQGLHD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.