NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24134J36421_10085472

Scaffold JGI24134J36421_10085472


Overview

Basic Information
Taxon OID3300002564 Open in IMG/M
Scaffold IDJGI24134J36421_10085472 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)785
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow, Alaska, USA
CoordinatesLat. (o)71.290565Long. (o)-156.788622Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021887Metagenome217Y
F042085Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
JGI24134J36421_100854721F021887N/AMDIGVEPDSLAAFRRRRAKRDDLPPLPLRPLIAEYTATFGSTWRPVTRRKHADDFARLIAWLTANGKPITTASLDFPTLVDYVEYLRVRPKVSGVWRGAPDALGRSLRHVPVETLSANSVNAYMRPLRALGIWLVDEGLLAQDPFRRSRRRAA
JGI24134J36421_100854722F042085GAGGMPADDEFRARLREVLARSGLSMRALSAALGRDPGYVAALLDPSRPSRARPTPADLLRASDATGIPFVELLEALWGIDPRRLADELT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.