Scaffold C688J35102_120901492

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold C688J35102_120901492

Scaffold C688J35102_120901492

Overview

Basic Information
Taxon OID	3300002568 Open in IMG/M
Scaffold ID	C688J35102_120901492 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from Hopland, California, USA - 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2149
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location
Location Name	Hopland, California
Coordinates	Lat. (^o)	38.99297339	Long. (^o)	-123.0674491	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035045	Metagenome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
C688J35102_1209014923	F035045	AGG	MLEIALGQKWIMADATFGTFFAEAIEVLEDGISGTVIITDEKGNIVDTFTGTAAEFQASGEWCLLEG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.