Scaffold JGI24136J36422_10148757

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24136J36422_10148757

Scaffold JGI24136J36422_10148757

Overview

Basic Information
Taxon OID	3300002569 Open in IMG/M
Scaffold ID	JGI24136J36422_10148757 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	608
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	Barrow Environmental Observatory site, Barrow, Alaska
Coordinates	Lat. (^o)	71.29053	Long. (^o)	-156.788654	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081499	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24136J36422_101487571	F081499	AGG	VKVFSLENAYVVERAQVFKVTEGSNDAIVTGEMADTPPGS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.