NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DRAFT_11173873

Scaffold DRAFT_11173873


Overview

Basic Information
Taxon OID3300002597 Open in IMG/M
Scaffold IDDRAFT_11173873 Open in IMG/M
Source Dataset NameCamel rumen microbial communities from Jandagh-Isfahan, Iran - Sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)889
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Camel Rumen → Camel Rumen Microbial Communities From Jandagh-Isfahan, Iran

Source Dataset Sampling Location
Location NameJandaq, Isfahan Province, Iran
CoordinatesLat. (o)34.041281Long. (o)54.414582Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015685Metagenome / Metatranscriptome252Y
F023770Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
DRAFT_111738731F015685N/AMAKITLHGMFARVKGKFNKSETLYFKGCPCGKEQLGVDLLNPSKAKESKNVQCQAALKTAAQAAKTALADPTERVTLEAGFKAQSKYTSLFAYTVAQKYVKPNFD*
DRAFT_111738732F023770N/AMARVEFDIGIDSVRGILMGTDPFYIRRYPERGGGVMHIVQARPNRSSHVPSPAEAANRVSFGAQFGTQRHIDFLERKWKGQLELPFCE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.