NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0005252J37289_104766

Scaffold Ga0005252J37289_104766


Overview

Basic Information
Taxon OID3300002674 Open in IMG/M
Scaffold IDGa0005252J37289_104766 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_10m (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1905
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)48.7299Long. (o)-123.5699Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001217Metagenome / Metatranscriptome745Y
F059342Metagenome / Metatranscriptome134N
F067108Metagenome / Metatranscriptome126Y
F103885Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0005252J37289_1047661F067108N/AEVVDFSVFTKFTKDLGLFQVDASIWSMVSQDCRQNHDISDIELEFSMNNKPCKYLGFKELYEKLYGINTFNKFRDNLKEEFEKAYFKHTPYKTK*
Ga0005252J37289_1047662F001217AGGALKKHTLNTHLIKLNNMSATKFNGFEKYFIQTALKHAIEEAEKDVLAIEADGNRCIYAPGYFTMVGNEIIKKVNHMTLKKHQD*
Ga0005252J37289_1047663F059342N/AMSENKYNGYTDFPTWKVFHETLSNIEFDEYVTPEDLEEISKDVVLFGFKMQFGSHLVEELARLFIESADFQDIADSINNDIR*
Ga0005252J37289_1047665F103885N/AMATLLERLKPKYRKKIENSQYTYTSSRIIARLENSKFYGDLTISEVREIYDMCDIEALRVSAWDYRFGDNILNRDND*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.