Basic Information | |
---|---|
Taxon OID | 3300002700 Open in IMG/M |
Scaffold ID | draft_1430164 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe - PAS_821 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1758 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fort McMurray, Alberta, Canda | |||||||
Coordinates | Lat. (o) | 55.07 | Long. (o) | -110.53 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045540 | Metagenome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_14301641 | F045540 | N/A | ISDMFDENLDEIDFIKSLSELELIYGFEIPGELFDRTGMTLGEFADELSQLPVIPDNLYPEFFDIKFTSMKLPKRYIELENKTDVDSVQELEEINNQFELLTDRLNVLLGNILVN* |
⦗Top⦘ |