NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25156J39149_1000041

Scaffold JGI25156J39149_1000041


Overview

Basic Information
Taxon OID3300002705 Open in IMG/M
Scaffold IDJGI25156J39149_1000041 Open in IMG/M
Source Dataset NameArabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)106358
Total Scaffold Genes117 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)77 (65.81%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location NameUniversity of North Carolina, USA
CoordinatesLat. (o)35.9082Long. (o)-79.0499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045820Metagenome / Metatranscriptome152Y
F062395Metagenome / Metatranscriptome130Y
F077376Metagenome / Metatranscriptome117Y
F092337Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
JGI25156J39149_100004119F077376AGGAMTTYVLSLTGDEEKAANATHWAKFRRAKLISVSRRADERMPDAGRDSIVIAEHGAGDRRATSCNPSTHDPAALAALLVRTLDIQDGTGVVLADFDNEEFAADVVARIADLGRRVTCTGQLRDFSFGARVRPLFARAA*
JGI25156J39149_100004137F062395GGAGGLKRVVAGSHVHAETKTSFRYEATWHVEGPLLAWKAEVSLPGRRWALAGGTPEWTGGNEAKAVREDIARSIDGLEA*
JGI25156J39149_10000414F092337N/AMRTTDSAMRSLRTATFTISIRDSSEDQLEAAAAAFTCTLHRAGMTPEDALLAWRRMDEWERRNFAADADPGPQWWRTMAIARDAVLAALRAAGLDGQRRPFMIEPATRPH*
JGI25156J39149_100004155F045820GAGGMTANTSSPRRDDRTRDDLPDGRNGRVVGENDDNVLESIGKAVVAPVEGADEGAEPVDGQHGRAFVDLTRTLPQGQSATPRTPTAPKPGGKAL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.