 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300002705 Open in IMG/M |
| Scaffold ID | JGI25156J39149_1028518 Open in IMG/M |
| Source Dataset Name | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 861 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 35.9082 | Long. (o) | -79.0499 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044585 | Metagenome / Metatranscriptome | 154 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI25156J39149_10285181 | F044585 | AGAAG | MSAAEIDHVALTALRLLPDEPDRAMRLWDNAFARASASGQDGMARSLLRLRIVRMHFQARFGDRDALEPPMLAASAEARVHGWRVESLLVDLLEVYLATLGGNHDEGLRDVEAIRAEAEAHLDPIELSAMELMAGHFRGYMLGW |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |