NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J40625_100006780

Scaffold B570J40625_100006780


Overview

Basic Information
Taxon OID3300002835 Open in IMG/M
Scaffold IDB570J40625_100006780 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21174
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (68.29%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011394Metagenome / Metatranscriptome291Y
F042904Metagenome / Metatranscriptome157Y
F066776Metagenome / Metatranscriptome126Y
F072349Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
B570J40625_10000678010F011394AGGAMFIDKNKDHFKYGVNEWTGEPNKPVFYTKEMAKKVRELKSPAPNLEMDIVKYPEFLAIRLYENNFAQYDGSMRVRVIEYIEMVKNILQSYGVRVELEGKPGGKNNG*
B570J40625_10000678012F066776AGGLLHLTEKGVEIFIKRSQTKSQESFWNNYDLVIWQKDNGGYTSTNGMYRQNAWGKSEKFSVNREGTWKLPKKYVKYFK*
B570J40625_1000067803F042904N/AMAELTVMDEIIGEVAEDLYNKWVSAMPDEEKNQHAFSAMSKNAHETTLFVIQEFMNKFNAAAEELRDK*
B570J40625_1000067809F072349GGAGLNLKESQGVRTMDKVLCYSCNKSKNELTAKKSTLLAINLLLCKTCTENKFEPRWIVILAGRQYGADHVKEFIAKKKYIGVDITASELLI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.