Basic Information | |
---|---|
Taxon OID | 3300002835 Open in IMG/M |
Scaffold ID | B570J40625_100849431 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 796 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → Candidatus Nanoarchaeia → Nanoarchaeales → Nanoarchaeaceae → Nanoarchaeum → Nanoarchaeum equitans | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Mendota, Madison, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.099444 | Long. (o) | -89.404444 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004132 | Metagenome / Metatranscriptome | 451 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
B570J40625_1008494311 | F004132 | AGGA | MSDALTQDQLSVPYNPNLLVTYKALPETYPAPESPTFMTDKVTDIEWQLHRSRQYENIAAERRLDISWLEDQIPEWYDPNYSKEDVLKALAEHFDINPVKQMNVYGTITFSGTISIPLDEIENFDLSNVTIDAEVSSYEYDADLTVDDVSLEEN* |
⦗Top⦘ |