NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold draft_10002974

Scaffold draft_10002974


Overview

Basic Information
Taxon OID3300002856 Open in IMG/M
Scaffold IDdraft_10002974 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2066
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSyncrude tailings pond, Wood Buffalo, Alberta, Canada
CoordinatesLat. (o)57.02Long. (o)-111.55Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090293Metagenome / Metatranscriptome108N
F098942Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
draft_100029741F090293N/AVLDLFVNYGNLDLSMQMQRPAESGLFFNLVNRSSTMSERTPTAKRSIAPVTVTVEITATRINENGTLSGITAKVVKQPIKGNEFKTSVPPMAGGAIYLKALSLDGLQIVSDDAPKAVGAKVKLF*
draft_100029742F098942AGGAGMSAKAKGERKVRKQESNKFVVKWIEGDSIFFRWFKRDRYAVQFQQELIDDGISPEHVRIHMK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.