NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold draft_10415963

Scaffold draft_10415963


Overview

Basic Information
Taxon OID3300002898 Open in IMG/M
Scaffold IDdraft_10415963 Open in IMG/M
Source Dataset NameMetagenome Biopara biogasfermenter May 2013 pooled
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)624
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)50.823236Long. (o)7.142629Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048180Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
draft_104159631F048180AGGAGGMKWLKVKGGFRHEGVKYDNEKEMPFPETLDELIAEYPEEVIVKKFNAELRRNYAQQLRDEKAQELGLQKISKAEQAQIDFIKEILETLGVETDELRTLAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.