NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGIcombinedJ43975_10061775

Scaffold JGIcombinedJ43975_10061775


Overview

Basic Information
Taxon OID3300002899 Open in IMG/M
Scaffold IDJGIcombinedJ43975_10061775 Open in IMG/M
Source Dataset NameSoil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)644
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa)

Source Dataset Sampling Location
Location NameManhattan, Kansas, USA
CoordinatesLat. (o)39.214Long. (o)-96.5852Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069219Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
JGIcombinedJ43975_100617751F069219N/AMSEETRKDIVLIVIFSLVSATGMASVFLGCRFLARIVIVVSDLYLFSVLLLAALRSDDDGFLRRHAWITRFFPRKTTGIFVALLFLAIVSGFAGLYVGAEVF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.