Scaffold JGI25382J43887_10002796

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25382J43887_10002796

Scaffold JGI25382J43887_10002796

Overview

Basic Information
Taxon OID	3300002908 Open in IMG/M
Scaffold ID	JGI25382J43887_10002796 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7741
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (45.45%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	Angelo Coastal Reserve, California, USA
Coordinates	Lat. (^o)	39.718176	Long. (^o)	-123.652732	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011834	Metagenome	286	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25382J43887_100027962	F011834	GGTGG	MVIEADFYRVRLRFKRLFADPSIFEDQGNAAQRYLFSRDTGDKAVSIYQITSDISPTDNVGKASEVAGTARYVHRKRVVRSEYFENANVTLEYSDFGSGISPTDHHRLWKKQKWGRMSFDLEEYHHEHLKIEIPDTAELFEMLRARADPTTLVDVELPELPENFFRSAVGYLETRLKQLAGAEHQAIEIYVARDLLLEEKQALEKRLTRPSTQSTIYIILSRAEAPTQL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.