NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25382J43887_10090874

Scaffold JGI25382J43887_10090874


Overview

Basic Information
Taxon OID3300002908 Open in IMG/M
Scaffold IDJGI25382J43887_10090874 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1627
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017459Metagenome / Metatranscriptome240Y
F026516Metagenome / Metatranscriptome197N
F087636Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
JGI25382J43887_100908741F026516N/AMEKVERMGAGLMWRIIGTIIAFSAFLVGSLIYVGFYTSGFDFTQKVIVVLVALILAFAAVAIMWVTFAGRRGWMRDRWGS*
JGI25382J43887_100908742F017459GAGMARKETRSNQPEVSSKSISPGLAEARRLLAIVEKSQVPFGESAPIFAKIKAEIDSGKSLSVEDHERLLRLVKIARDWNKAEESSALTEPDETLSG*
JGI25382J43887_100908744F087636N/ARFEDVVKILHERLGTSARVIAYRTMVELYKEFSLSANFDYEDSIEDRFVFLKERVLADRLHPTRTPSLKLAF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.