Scaffold JGI25616J43925_10117561

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25616J43925_10117561

Scaffold JGI25616J43925_10117561

Overview

Basic Information
Taxon OID	3300002917 Open in IMG/M
Scaffold ID	JGI25616J43925_10117561 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1084
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	Laytonville, California, USA
Coordinates	Lat. (^o)	39.7392	Long. (^o)	-123.6308	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084645	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25616J43925_101175612	F084645	GGAGG	MAAKKMFPPREVGNPLGKAYDEVKLGISFRILAGQIVMQFSDHVEWIRMSSAGARRLAAMLVEKANEQDRLGSK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.