Basic Information | |
---|---|
Taxon OID | 3300002920 Open in IMG/M |
Scaffold ID | Pfga_1085554 Open in IMG/M |
Source Dataset Name | Hot springs microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA-MHS Pond Facies_Gas lift |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Illinois, Urbana-Champaign |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2286 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs → Hot Springs Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone Mammoth Hotsprings | |||||||
Coordinates | Lat. (o) | 44.9766 | Long. (o) | -110.7016 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029994 | Metagenome / Metatranscriptome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Pfga_10855541 | F029994 | GGAGG | MPIRFIKRRTDIPVIEDRPLLIVRCRRCGLTTVARSPDAETVRGWQLPDRWPYDAPQLGTAIEGLC |
⦗Top⦘ |