NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Pfga_1088300

Scaffold Pfga_1088300


Overview

Basic Information
Taxon OID3300002920 Open in IMG/M
Scaffold IDPfga_1088300 Open in IMG/M
Source Dataset NameHot springs microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA-MHS Pond Facies_Gas lift
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3209
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs → Hot Springs Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone Mammoth Hotsprings
CoordinatesLat. (o)44.9766Long. (o)-110.7016Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022604Metagenome / Metatranscriptome213N
F025421Metagenome / Metatranscriptome201Y
F038570Metagenome / Metatranscriptome165N
F093039Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Pfga_10883003F022604GAGGVLSAVNAVHAVVSTVTGITAAYKTVPMSANTTALPMALVTPISENRRQHAHELVRIETLVRVRIVHSPIAQGITESQQSALYTLADDVMTKITDDITLGGQVDHVASVDADEPSIYTLSGTDYLSISVAVRVVEKV*
Pfga_10883005F038570AGGAGMPATHLRRIQLGQQTSFATPVAATSILRGLKDGSITVNHNDMVVEELGRSVSDLVVVSQRHAEGEIELQCTYEDVLYGLFGLFGPVAPTANVRTFNAPVTSYAAPQIYTIEYGAPGAEYRVIGGLINEWTMRYEANAGVTESWSIIGRSVQANALTGSLPTRAVTPVVSRHASWYVDNIGTAHGTTAIPGTVIEAELSINTNRHLKMFEGSQPLDWGEGRWEAQLTMTAEFNATAKAWVDSMLANHVARNIRANFVETANTRELRIDFVGLIAEPIELFGDRDGNMTVELTFNALVAGPLNNWLQIRVINGVATLP*
Pfga_10883006F025421N/AMIDLSKVRRIDRNAPGSFLEYARLQAVIAEGDLMAIARALENYGVDLQKLSFNDLQEVVKHIAGEPTPLADTNATA*
Pfga_10883007F093039GGAVILLLHLAETWGVPPWVLERELSLFWAEAVCEYEREKARQAKRAMRKYGGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.