NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Water_100361

Scaffold Water_100361


Overview

Basic Information
Taxon OID3300002930 Open in IMG/M
Scaffold IDWater_100361 Open in IMG/M
Source Dataset NameEstuary water microbial communities from Pearl Estuary, Zhujiang, China
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10093
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (53.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water → Estuary Water Microbial Communities From Pearl Estuary, Zhujiang, China

Source Dataset Sampling Location
Location NamePearl Estuary, Zhujiang, China
CoordinatesLat. (o)22.67Long. (o)113.71Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001668Metagenome / Metatranscriptome654Y
F024541Metagenome / Metatranscriptome205N
F063638Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Water_10036111F001668GGAMATVYLPVEPIEGMDSAQRADALDAEVWALLRPAALQLPQDTKYLYPRTVHPDTGQTAIIGDTTDDIYIHPDVDLTELLALLPEVPQEEKDGLVMFIDANRGGSVPFGQLIPSTSTQLTEEEARALGWIPDPIEP*
Water_1003612F024541GGAMIISQYGSVHKCAAKLGTNREQLLRQIRTGNDQVLDAIADNCRLSRQEVRWEFRYHTENA
Water_1003618F063638GAGMLDTLDTLTAVIDTVTTVVIVDPVILDPMEPWYVTHYVELIFIALAAAKAVLNLVPSEKPRVLFGYLDTLIGLIFKDRRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.