NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Water_101001

Scaffold Water_101001


Overview

Basic Information
Taxon OID3300002930 Open in IMG/M
Scaffold IDWater_101001 Open in IMG/M
Source Dataset NameEstuary water microbial communities from Pearl Estuary, Zhujiang, China
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5555
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water → Estuary Water Microbial Communities From Pearl Estuary, Zhujiang, China

Source Dataset Sampling Location
Location NamePearl Estuary, Zhujiang, China
CoordinatesLat. (o)22.67Long. (o)113.71Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005200Metagenome408Y

Sequences

Protein IDFamilyRBSSequence
Water_1010012F005200AGGAMDPITIFAACKAAHAGIKECVELYNDFKQDGKDLSGIVTDISQHLGKFFTHNEEFKTAEKEAQKTPLPKNVSINEEAMNRVLRQEQMQQMETELREMIIYQVGMPGLWSKFAEMRVVVQKEREKVEREQKKPWQKLRTNVDFLFKNTKFEPQYTLQF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.