 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300002930 Open in IMG/M |
| Scaffold ID | Water_102352 Open in IMG/M |
| Source Dataset Name | Estuary water microbial communities from Pearl Estuary, Zhujiang, China |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3274 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water → Estuary Water Microbial Communities From Pearl Estuary, Zhujiang, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pearl Estuary, Zhujiang, China | |||||||
| Coordinates | Lat. (o) | 22.67 | Long. (o) | 113.71 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033763 | Metagenome | 176 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Water_1023521 | F033763 | GGA | MAQGSLEGKGGGIGFEGIGADIKPLLQQFEAMRKEINQKNVQRRIHRAAGKLFKDEMVRNIQDADDVVRIRRGKAKPLDIPIGTLNRSVRVWLIDKQQNAYWVGPRVGKKMPLRSDGWFANIVEGGDQSFGVGRNKGVFARSIKNKRNAAEQLMIKKYKNAIDKAVKAKAKTTKK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |