NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold G310J44882_10002512

Scaffold G310J44882_10002512


Overview

Basic Information
Taxon OID3300002933 Open in IMG/M
Scaffold IDG310J44882_10002512 Open in IMG/M
Source Dataset NameCombined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)7412
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (84.21%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022576Metagenome213Y

Sequences

Protein IDFamilyRBSSequence
G310J44882_1000251215F022576GAGVTIDLKEHMKKKTQAKHVKAYDAIGRAVDGMTIGTVLHIMASFTASVLANMEEPDRTKAAMVFSSMIMSNPTDEKSILQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.