Scaffold JGI11641J44799_10084413

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11641J44799_10084413

Scaffold JGI11641J44799_10084413

Overview

Basic Information
Taxon OID	3300002961 Open in IMG/M
Scaffold ID	JGI11641J44799_10084413 Open in IMG/M
Source Dataset Name	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	895
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location
Location Name	Twitchell Island in the Sacramento/San Joaquin Delta, CA
Coordinates	Lat. (^o)	38.107057	Long. (^o)	-121.647578	Alt. (m)		Depth (m)	0 to .12
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019578	Metagenome	229	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11641J44799_100844132	F019578	N/A	MEKNANGSLYVKKKDESIGVFGADSSVVAVLPKKKNGDDTRIAEAYLFAAAPQLFEVCRIIHSILENSLIVTPEGFKINCSDIKISLRDAILRAKGYRKNPDEP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.