NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052239_103015

Scaffold Ga0052239_103015


Overview

Basic Information
Taxon OID3300003099 Open in IMG/M
Scaffold IDGa0052239_103015 Open in IMG/M
Source Dataset NameFresh water viral communities from Lake Needwood, Maryland, USA - June 2007
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)918
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md

Source Dataset Sampling Location
Location NameLake Needwood, Maryland, USA
CoordinatesLat. (o)39.121Long. (o)-77.129Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005480Metagenome / Metatranscriptome399Y
F036592Metagenome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0052239_1030151F036592N/AATETWANASNIGLGEIDPGEYTMSSRQLTDAVISSVANQIASSALGYFYEDANGLISYADASHRQDYLTANGYTDLDAGTAIGPGIGIVQRQGDLVNKVVIDYGNNFGSQYTAQDAESQAIYGLYAEQFSSYVKSASDVEDMADRLIQLRAFPSYQFQSITFPLQSPEIDDTDRDALXTSLWVCQCESPTYRLKCLAANLLAMSKAGRLGRQWEGLA*
Ga0052239_1030152F005480AGGAGMATTTNYGWETPDDTDLVKDGALAMRTLGNSIDTSLAELRGGTTG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.