Scaffold Ga0052233_107483

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052233_107483

Scaffold Ga0052233_107483

Overview

Basic Information
Taxon OID	3300003118 Open in IMG/M
Scaffold ID	Ga0052233_107483 Open in IMG/M
Source Dataset Name	Human gut microbiome from lean and obese individuals in Granada, Spain - Obese sample
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1327
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Human Gut Microbial Communities From Lean And Obese Individuals In Granada, Spain

Source Dataset Sampling Location
Location Name	Granada, Spain
Coordinates	Lat. (^o)	37.17	Long. (^o)	-3.59	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0052233_1074831	F067844	N/A	MNTLAAETASAWYLILNRKRPTKKVIASYFNMTQFSSHLPRNPDAGNKQVSAGAVVITPQHRFTRAPQGSPKSLGGREEV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.