NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052233_110406

Scaffold Ga0052233_110406


Overview

Basic Information
Taxon OID3300003118 Open in IMG/M
Scaffold IDGa0052233_110406 Open in IMG/M
Source Dataset NameHuman gut microbiome from lean and obese individuals in Granada, Spain - Obese sample
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute of Catalysis, The Higher Council for Scientific Research (CSIC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)795
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Human Gut Microbial Communities From Lean And Obese Individuals In Granada, Spain

Source Dataset Sampling Location
Location NameGranada, Spain
CoordinatesLat. (o)37.17Long. (o)-3.59Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039198Metagenome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0052233_1104061F039198AGGAGMQITNTEIQGTKYVQIYLTEEELQKKETKDLVKKYKQEKYSVAIFVSGKENYPEILEKIITKQVGLNRNVC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.