Scaffold Ga0052258_104464

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052258_104464

Scaffold Ga0052258_104464

Overview

Basic Information
Taxon OID	3300003126 Open in IMG/M
Scaffold ID	Ga0052258_104464 Open in IMG/M
Source Dataset Name	Human gut microbial communities from lean and obese individuals in Granada, Spain - Lean sample
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	533
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Human Gut Microbial Communities From Lean And Obese Individuals In Granada, Spain

Source Dataset Sampling Location
Location Name	Granada, Spain
Coordinates	Lat. (^o)	37.17	Long. (^o)	-3.59	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056682	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052258_1044642	F056682	N/A	MKMQSRAGKAANQPIERGKMYSASFRGFPSKNRITFPIQELGKIYENQEVL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.