NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052190_104868

Scaffold Ga0052190_104868


Overview

Basic Information
Taxon OID3300003129 Open in IMG/M
Scaffold IDGa0052190_104868 Open in IMG/M
Source Dataset NameOlavius algarvensis microbial community from off the coast of Capo di Sant Andrea, Elba, Italy
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI), Max Planck Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1476
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Integument → Unclassified → Unclassified → Olavius Algarvensis → Olavius Algarvensis Microbial Communities From Capo Di Sant'Andrea Bay, Elba, Italy

Source Dataset Sampling Location
Location NameBay off Capo di Sant'Andrea, Elba, Italy
CoordinatesLat. (o)42.807222Long. (o)10.141111Alt. (m)Depth (m)5.6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023283Metagenome210Y
F088370Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0052190_1048682F088370N/AMALPDESLVKDVWFAMWGVQTHARREKVPGPCRNFGKLANSCFEHWLTKPDVLRLYAEKVLAAPFDPRETSQQLQRLLHFDTARACIRLISLLEKARSK*
Ga0052190_1048683F023283N/ALGRSGEAEKERKRHDLAIEELQRAASEYQHKRQLRLDYLNQQLRAEQHSAQVFEDVDAAAREYWLVTGGDQEKLDKAPGAGAVPTLNEYYEPSATQKGYELLFMAGGLALSGWAAFKFL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.