Basic Information | |
---|---|
Taxon OID | 3300003142 Open in IMG/M |
Scaffold ID | Ga0052242_1024654 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsf |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Japan Agency for Marine-Earth Science and Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 850 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Deep Subseafloor |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Northwestern Pacific Ocean | |||||||
Coordinates | Lat. (o) | 41.1773 | Long. (o) | 142.2013 | Alt. (m) | Depth (m) | 1180.5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044219 | Metagenome | 155 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052242_10246541 | F044219 | GGA | MANAKTKEFEIYVTTLADPTADNTTLDMTDYVDIADNQAFEVHEVDIVLDPTETFPSALTECIFQLADSNIQAFVSHADRTSLYIARQTFDNASLGMWHQESFSSITPLIVQKTLFLRQQNTAGGLSLNFTLRIKGRIVSPSAKDYMALVLTQTGNVA* |
⦗Top⦘ |