NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052262_1109896

Scaffold Ga0052262_1109896


Overview

Basic Information
Taxon OID3300003148 Open in IMG/M
Scaffold IDGa0052262_1109896 Open in IMG/M
Source Dataset NameAlgal bloom microbial communities from Baltimore Inner Harbor, Chesapeake Bay
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)726
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor

Source Dataset Sampling Location
Location NameBaltimore Inner Harbour, Chesapeake Bay, Maryland, USA
CoordinatesLat. (o)39.283Long. (o)-76.611Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033297Metatranscriptome177N

Sequences

Protein IDFamilyRBSSequence
Ga0052262_11098961F033297N/AKIDSKSASSAQLKEEVKVLQGELAALAKEQAELTQTRSDESAAYAKAKADLELGLMGVRKALQVLRKYYQGDGAAMLQASDAQPAKPVFHSKASGAGGSIIDILEVVESDFAKNLAEEEETESDAAAAYEKRTQEIKVSTAMKSQSVTYKVQEFKGLDKDVNELSSDRASTNTELDSVLEYYGKVKERCIAKPETYEVRAARRQREIKGLKEALAILSDETAPALLQARGVRGARRQAVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.