Scaffold JGI26341J46601_10005600

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI26341J46601_10005600

Scaffold JGI26341J46601_10005600

Overview

Basic Information
Taxon OID	3300003219 Open in IMG/M
Scaffold ID	JGI26341J46601_10005600 Open in IMG/M
Source Dataset Name	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4122
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location Name	Calvert Island, British Columbia, Canada
Coordinates	Lat. (^o)	51.62	Long. (^o)	-128.09	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018065	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26341J46601_100056004	F018065	GAGG	MTGKEIQKLDYVREGVRYTIHVEEVDGPVMWGTWNCNECSVGGSSGRKSTTIDEAVDAAKSDLERHHITNHKV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.