NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26118J46590_1026583

Scaffold JGI26118J46590_1026583


Overview

Basic Information
Taxon OID3300003265 Open in IMG/M
Scaffold IDJGI26118J46590_1026583 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)681
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameMonterey Bay, California, USA
CoordinatesLat. (o)36.25Long. (o)-122.2099Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095050Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
JGI26118J46590_10265831F095050N/ALLDISKEEDKFVVTLDVPQNNHNIVGSEFRIGYDNTRVEFDRIETTSNLQSFSAERTNYIKLGSISTDGSQNLNGGVQYKIYFSPQQTFESILGLLSVTKSELVKQNGGGISHIIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.