NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold soilL1_10072563

Scaffold soilL1_10072563


Overview

Basic Information
Taxon OID3300003267 Open in IMG/M
Scaffold IDsoilL1_10072563 Open in IMG/M
Source Dataset NameSugarcane bulk soil Sample L1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5929
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. LW4(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location NameAyr, Queensland Australia
CoordinatesLat. (o)-19.733298Long. (o)147.17873Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024574Metagenome / Metatranscriptome205Y
F066908Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
soilL1_100725634F024574GAGMLHRGAMAVMCVGMLGLITASCDDMPEHAPTINGAEFRPGLSLEPTPISFIAPSGVPCPLGGFPFVPSFHLVVTSGIQDITLNSVTIHMIDGSNLGGPSIVIPQPELAARFGSTLIVAGTSRDFALRPDFGCIARVPTALRSSALLLDARGVPQTIVVQGRVQ*
soilL1_100725635F066908N/AVAGVLDGQSLGQFTPGLLYEVDDALARQLISMGCAREEHSQAPALVKRLADEPLDEARLTGGVRVVPRAQADDDSKADRRHGTADRRKHPRTDRRKPPS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.