NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0006243J48910_1011897

Scaffold Ga0006243J48910_1011897


Overview

Basic Information
Taxon OID3300003302 Open in IMG/M
Scaffold IDGa0006243J48910_1011897 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C49A8_35 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1224
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameMonterey Bay, California, USA
CoordinatesLat. (o)35.7899Long. (o)-122.3199Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059628Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0006243J48910_10118971F059628N/ALLLAGRLGMAVGNPIITDSKKSQTMKVALGMFLVVVATVAIVAVSMHQQPELEELAAKKGAKKAAPLTFGSSITLMTAYNEYIVVTKAGKVYMDGFLNGNDVIKXVNPKGGKKGAVKYGAKVAFMGQNGKYFLSRYSGKVTCRTSVLGQDTTWTIVGGSGGVMIADRVSFKNEYGFLRVSTDGANSNQPTTTASEKYLIGLPGQENGLKLGNGLHYGEVITLMNPTFEYLQIDHNGWATMGGKPADNWHHFAVLSSIHREGVISYGDKLVLRAHNGRFVSVRQDSLALEAVSRSITDESEFTLIGGPGFGSGYAHDRDMVCLRNYQGYIDSKHGETRVNMGQDGHYGPDNVLQMKKVWDSSL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.