Basic Information | |
---|---|
Taxon OID | 3300003303 Open in IMG/M |
Scaffold ID | Ga0006246J48908_1028361 Open in IMG/M |
Source Dataset Name | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C33A6_35 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 877 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Monterey Bay, California, USA | |||||||
Coordinates | Lat. (o) | 36.25 | Long. (o) | -122.2099 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003423 | Metagenome / Metatranscriptome | 487 | Y |
F054895 | Metagenome / Metatranscriptome | 139 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0006246J48908_10283612 | F003423 | GGAGG | MEEFDAPQEHGVKQMRETIGRKDDAIKKLEAELESYKDKEIDNVFGKLGLSTDKGFGKALKQVYDGPVTTDAISQFAKDEYGFEANGTVETTPQSPPEPQVQDDARSRVAALDANSTSEIPLGSNEELVAALKGASVKDSLRAKLNYMDQEQQKK* |
Ga0006246J48908_10283613 | F054895 | GGAGG | MAGISLTNDAIYSQKINNFSGELFRVGGQRTPFLSATGGLNGGKVLQSTFWQIQAADSHTVSSEP |
⦗Top⦘ |