NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0006883J46559_1122268

Scaffold Ga0006883J46559_1122268


Overview

Basic Information
Taxon OID3300003307 Open in IMG/M
Scaffold IDGa0006883J46559_1122268 Open in IMG/M
Source Dataset NameHypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Zoopagomycota → Entomophthoromycotina → Entomophthoromycetes → Entomophthorales → Ancylistaceae → Conidiobolus → Conidiobolus coronatus → Conidiobolus coronatus NRRL 28638(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameElkhorn Slough, Monterey Bay, California, USA
CoordinatesLat. (o)36.7999Long. (o)-121.7999Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004248Metagenome / Metatranscriptome446Y

Sequences

Protein IDFamilyRBSSequence
Ga0006883J46559_11222681F004248N/AGTSDTYHEDKILNKYLSLDSEGKELVYKAAVQLAIIGYGSKNYGFVRKNEDEIVNLTDIFKKYGIKYLEKLNSKYNEDDLSVRRLLRLFRYQISRFIIENQRPSYLWLKYSNKNKNFIHICFPGGEHMVENKEEAEYLISTYSNLDVQLGTKFRDRLRRVFIARNI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.