NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold soilH2_10075899

Scaffold soilH2_10075899


Overview

Basic Information
Taxon OID3300003324 Open in IMG/M
Scaffold IDsoilH2_10075899 Open in IMG/M
Source Dataset NameSugarcane bulk soil Sample H2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2427
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location NameAyr, Queensland Australia
CoordinatesLat. (o)-19.733298Long. (o)147.17873Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001743Metagenome / Metatranscriptome643Y
F041924Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
soilH2_100758991F041924AGGMKQTVVAPDGLRWTVRRLIVPTGMRPMTRTEMLDAAAPRRTVVDGMSRQVPDAIGAPTGPLPLGFLLVPLALPLVPFALLLRRARLLPWTIEARAYPWGRRYPPIVLTYAVRGGDETRRALVHVAAALARGDGAPVVDGAEMFAQARDAHSAAAVVGSSGPRQFGK*
soilH2_100758994F001743GGAGLPELSCEACGWVAITTQPPNLVWAEHEKSCPAVGGAVRHMPEPAPRQRFLGSVKECNHRLVRKHIATTPSGVKKYAVMCELCGRFVG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.