NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GBSed_10064705

Scaffold GBSed_10064705


Overview

Basic Information
Taxon OID3300003332 Open in IMG/M
Scaffold IDGBSed_10064705 Open in IMG/M
Source Dataset NameMarine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1203
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment → Marine Hydrothermal Vent Sediment Microbial Communities From Guaymas Basin, Gulf Of California

Source Dataset Sampling Location
Location NameGuyams Basin, Gulf of California, Pacific Ocean
CoordinatesLat. (o)27.01Long. (o)-111.43Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040961Metagenome160N

Sequences

Protein IDFamilyRBSSequence
GBSed_100647054F040961AGGGGGMVNAVECRWSEEQARALIIFLLAEKKRHERDIHNINRSIERIKREFNFTEADIAKCEKLAWLYVNF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.